PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G557300.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 917aa    MW: 102263 Da    PI: 5.3117
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G557300.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.62.4e-28597647252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Sevir.9G557300.4.p 597 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 647
                         799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.006586667IPR003035RWP-RK domain
PfamPF020424.3E-26599647IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2407.1E-24815899No hitNo description
SuperFamilySSF542771.3E-21816898No hitNo description
PROSITE profilePS5174522.045818901IPR000270PB1 domain
SMARTSM006665.4E-22818901IPR000270PB1 domain
CDDcd064073.38E-40819900No hitNo description
PfamPF005641.7E-15819899IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 917 aa     Download sequence    Send to blast
MEQPAAQKDE DGLLGYAVME DVAVGDLDLM EELFMAAPGF DFSDFSQPGP GASPGACFSP  60
LFDICSTTTT ATPPAPAGDD DRDDTERPEA RRAWLFQPRQ EVEATVKERM RRALERIAQT  120
HPGELLAQVW VPTLIGDRQV LTTCGQPFWL DSRNQRLANY RSVSMKYQFS ADESACAELG  180
LPGRVFVGRV PEWTPDVRYF STEEYPRVHH AQFFDIRGSV ALPIFEPRSR ACLGVVELVM  240
TTQKVNYNAE IENICSALKE VDLRSTDVSS DPHANVSLNV ADTSYRAIVP EIIDVLRTVC  300
ERHELPLAQT WIPCICQAKR GSRHSDEKFK YCVSTVDEAC YIRDPNVTGF HQACSDHHLF  360
RGEGVVGRAF GTNEPCFATD VTAYSKAQYP LSHHAKLFNL KAAVAIRLRS IRTGSLDYVL  420
EFFLPVDCIE SEEQRAMLNS LSITIQQTCY TLRVVSLKEL VDEGSFETST VTPAEFYEKP  480
IHENLDEVCS NIEVPVRTTS LETSEEVTSW IASLVDAQSK GVKEMDGDLP FGFSKQEDEG  540
FSVTAGWHTP PVLGPKGTIF SGFKHHEEYE VKEPICSRHP SPSNLDKTVE KRRTKMEKTV  600
SLEELRKHFA GSLKEAAKNL GVCPTTLKRI CRQHGINRWP SRKIKKVGHS LKKLQMVIDS  660
VHGAEGTVQL SSLYENFTKT TWSERELQGD GTYPLSEQKG HLEPSVPDRQ CEGRFTSHTS  720
GSNSMSPSCS QSSNSSHGCS SGSKSQQNGS APQLAVKQEV FMEENQSSTL LKAASHAELQ  780
MFTEERPVTL PRSESQMLLS ELKPVENMSG MQKSKPESLK IKAMYGEERC IFRLQPSWGF  840
EKLKEEIVKR FSIGQEMYVD LKYLDDESEW VLLTCDADLL ECIDVYKSSS AQTVRILVNA  900
NVQPVLGPSF GQTGLS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198111RQEVEATVKERMRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698188.10.0PREDICTED: protein NLP1-like isoform X1
RefseqXP_012698189.10.0PREDICTED: protein NLP1-like isoform X1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLK4A5H90.0K4A5H9_SETIT; Uncharacterized protein
STRINGSi034133m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein